PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g010340.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 424aa    MW: 48262.8 Da    PI: 5.1857
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g010340.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like62.77.2e-20127179154
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                         k r +Wt +LH++F+++v+qL G  +  Pk+i elm+v+gLt+ +++SHLQk R
  Sopim09g010340.0.1 127 KYRTKWTDQLHDKFMKVVRQL-GDGNCYPKKIFELMQVPGLTRIQIASHLQKCR 179
                         5699*****************.999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.74179IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23004.6E-4797No hitNo description
PROSITE profilePS5129411.731124183IPR017930Myb domain
SuperFamilySSF466891.75E-16125180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-20126180IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-18127180IPR006447Myb domain, plants
PfamPF002491.4E-6129178IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 424 aa     Download sequence    Send to blast
MSMLKKKQKI DVMILNVHPS NIYSFDLLAQ AVVLDVITLV VYDELNELVA KKALDKGAYL  60
SLKKPFDEEI LQYLWQIVLK RNMQREKARE GSEKNRDQIT IDDIYNNDNI NEGESQSNAI  120
NTVVRRKYRT KWTDQLHDKF MKVVRQLGDG NCYPKKIFEL MQVPGLTRIQ IASHLQKCRR  180
NNWRFKKEQR YVCAPSGHES KFGAMPRLQT NVLNPQRNSD EIQKGLGHSY STPNANNVFA  240
RGDNSIQQQF YRPQLQVQPY SFDIDNPFND SFLLAQNNVG MSSSQELEGS ITGNTNYKPA  300
WAFNNGDHDH AQYTYNNLNL NAVYGTTYSN NKTVSGANTG NVQVNEYNAN AENVAICSDN  360
AMMSDTYVGN VAINGVGETN TNFQQYIDES DIFATLCESD IEEADASEKE DCEAYYLNTE  420
YLL*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755210.0HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015161529.11e-154PREDICTED: two-component response regulator ORR24-like
TrEMBLK4CR610.0K4CR61_SOLLC; Uncharacterized protein
STRINGSolyc09g010340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-17response regulator 2